PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00330g01001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family NF-YB
Protein Properties Length: 230aa    MW: 25895.6 Da    PI: 6.7901
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00330g01001.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB170.71.6e-5354149297
                     NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86 
                               +eqdrflPianv+rimkkv+P+n+kiskdaketvqecvsefisfvt+easd+cq ekrktingdd+++al+ lGf+dyv+plk+y
  Peinf101Scf00330g01001.1  54 KEQDRFLPIANVGRIMKKVIPGNGKISKDAKETVQECVSEFISFVTGEASDRCQTEKRKTINGDDIIYALTILGFDDYVAPLKTY 138
                               89*********************************************************************************** PP

                     NF-YB  87 lkkyrelegek 97 
                               l kyrelegek
  Peinf101Scf00330g01001.1 139 LLKYRELEGEK 149
                               ********996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.1E-5247169IPR009072Histone-fold
SuperFamilySSF471133.11E-3956167IPR009072Histone-fold
PfamPF008083.4E-2759123IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.0E-1787105No hitNo description
PROSITE patternPS00685090106IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006154.0E-17106124No hitNo description
PRINTSPR006154.0E-17125143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MEDERQGNGP NVTIKSSPES TSRITPITTS TFTTNSSNVK NNNNNNNNKS TSTKEQDRFL  60
PIANVGRIMK KVIPGNGKIS KDAKETVQEC VSEFISFVTG EASDRCQTEK RKTINGDDII  120
YALTILGFDD YVAPLKTYLL KYRELEGEKL NVPKQQQQQQ QQQQQQQQQL VQLHDHTSNM  180
PSYNNVYSPT GLLPQASFLS TDQSFSLPFS QNSTQSQLTK QEQIDSVGHW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4csr_A1e-4452144294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B1e-4452144294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
1n1j_A1e-4452144193NF-YB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016552944.11e-102PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotQ9SIT94e-64NFYB7_ARATH; Nuclear transcription factor Y subunit B-7
TrEMBLM1BE772e-96M1BE77_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000431767e-96(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G13570.16e-63nuclear factor Y, subunit B7